PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_14223.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 324aa    MW: 36511.2 Da    PI: 8.2585
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_14223.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.22.2e-191461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rg WT+eEd +l+ +++q+G+++W++I++  g+ R++k+c++rw +yl
  Rsa1.0_14223.1_g00001.1 14 RGQWTPEEDNKLASYIAQHGTRNWRLIPKNAGLQRCGKSCRLRWTNYL 61
                             89********************************************97 PP

2Myb_DNA-binding45.61.6e-1468110246
                              SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              g +++ E+ ++v+ +  lG++ W++Ia+ ++ gRt++++k++w++
  Rsa1.0_14223.1_g00001.1  68 GQFSEAEEHIIVKFHSVLGNR-WSLIAAQLP-GRTDNDVKNYWNT 110
                              789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-25564IPR009057Homeodomain-like
PROSITE profilePS5129426.472965IPR017930Myb domain
SuperFamilySSF466893.15E-2911108IPR009057Homeodomain-like
SMARTSM007173.2E-141363IPR001005SANT/Myb domain
PfamPF002495.3E-181461IPR001005SANT/Myb domain
CDDcd001677.01E-121761No hitNo description
Gene3DG3DSA:1.10.10.609.8E-2465116IPR009057Homeodomain-like
SMARTSM007173.6E-1266114IPR001005SANT/Myb domain
PROSITE profilePS5129419.99466116IPR017930Myb domain
PfamPF002495.8E-1368110IPR001005SANT/Myb domain
CDDcd001671.02E-870112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0048658Biological Processanther wall tapetum development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MGRIPCCEKE NVKRGQWTPE EDNKLASYIA QHGTRNWRLI PKNAGLQRCG KSCRLRWTNY  60
LRPDLKHGQF SEAEEHIIVK FHSVLGNRWS LIAAQLPGRT DNDVKNYWNT KLKKKLSGMG  120
IDPVTHKPFS HLMAEITTTL NPPQVSHLAE AALGCFKDEM LHLLTKKRVD LNQINFSSPN  180
PNPNKFNRTV DNEAGKMKMD GMENGNGIMK LWDMGNGFSY GSSSSSFGNE EKNDGPASPA  240
VAAWRGHGGI RTAVAETAAA EEEEERRRKL KGEVVDQEEI RSLGARGDGM LMMRSHHDQH  300
QHHVFNVDNV LWDLQADDLI SHVV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28141167108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00564DAPTransfer from AT5G56110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196390.0AY519639.1 Arabidopsis thaliana MYB transcription factor (At5g56110) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009120123.10.0PREDICTED: protein ODORANT1
SwissprotQ9XHV00.0MYB80_ARATH; Transcription factor MYB80
TrEMBLM4CF650.0M4CF65_BRARP; Uncharacterized protein
STRINGBra002847.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM100052635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.10.0myb domain protein 103